PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011089326.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family ARF
Protein Properties Length: 795aa    MW: 87852.8 Da    PI: 6.3546
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011089326.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3741.8e-23177278199
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F   + + 
  XP_011089326.1 177 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyK-QQRPSQELIAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFL--RGEA 268
                     99****************************963.3445679************************************************..4499 PP

                     E..EEEEE-S CS
              B3  90 felvvkvfrk 99 
                     ++l ++++r+
  XP_011089326.1 269 GNLQLGIRRA 278
                     999***9986 PP

2Auxin_resp109.63.3e-36303384182
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                     +a+a+s++s+F+v+Y+Pras+++F+++++k++k  ++++ vG+Rfkm+++ +ds+err+sG+v+g sd+dp+rWpnSkWr+L
  XP_011089326.1 303 VANALSSNSTFHVFYSPRASRPDFIIPYQKYLKCATSQIPVGTRFKMRIDLDDSPERRFSGVVTGASDADPYRWPNSKWRCL 384
                     689******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.27E-44168284IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.2E-40170291IPR015300DNA-binding pseudobarrel domain
CDDcd100173.86E-22175277No hitNo description
SMARTSM010193.3E-22177279IPR003340B3 DNA binding domain
PROSITE profilePS5086312.858177279IPR003340B3 DNA binding domain
PfamPF023621.8E-21177278IPR003340B3 DNA binding domain
PfamPF065071.6E-30303384IPR010525Auxin response factor
PROSITE profilePS5174516.888685767IPR000270PB1 domain
SuperFamilySSF542773.68E-10685764No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 795 aa     Download sequence    Send to blast
MEIDLNHAMG EVDKNACANG GECDKGEGGS CVSCCLSTST SSCSSNAPSA SSSSCSISAS  60
SSILIELWHA CAGPLTSLPK KGNLVVYFPQ GHLEQSNSAS FPPVEMPTFD LPSKILCRVV  120
DVHLLANKDN DEVYTQLTLL PVPELEGVKL QGDENETKGV DEDGSGVAPA KSTSHMFCKT  180
LTASDTSTHG GFSVPRRAAE DCFPPLDYKQ QRPSQELIAK DLHGVEWKFR HIYRGQPRRH  240
LLTTGWSIFV SQKNLVSGDA VLFLRGEAGN LQLGIRRAAR PRSGLPDCII KNQNSYFNIL  300
PPVANALSSN STFHVFYSPR ASRPDFIIPY QKYLKCATSQ IPVGTRFKMR IDLDDSPERR  360
FSGVVTGASD ADPYRWPNSK WRCLMVCWDD DIMSNHQVRV SPWDIDSSGN YAPVSILTSP  420
GVKRLKSNQE PSPHGNPISG SDQILDFEES LRSSKVLQGQ ENIGLLSPIH GSDRINRQLH  480
FEMQPLALNH LQNRIEKLNY GEFMKNQTPA TFTGFLESNW FPKVLQGQEI CSLRSLAGET  540
GWNLGARSTP ELGCDVYNTH QRPSFTLYPL ASQGARNIPF SHTAGLKAGQ GPLVLSNISN  600
FQMGNHVLTP TSVLSGPTTD VSRVPNHRNE PWVLEKTSGP AIALTHLRNT TDKDNSQEKV  660
PICKLFGYSL TEDPAIVNSH SANKRSVTKV HKQGSLVWSA IDLSRLHGYN DLLTELERLF  720
SMEGLLRDPN HGWRVLYTDS ENDMMVLGDD PWHEFIEEVT KIHIYTQEEV EKLTVGVNSD  780
DTQSCLEEVP HVTDV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-1196041216359Auxin response factor 1
4ldw_A1e-1196041216359Auxin response factor 1
4ldv_A1e-1196041216359Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089326.10.0PREDICTED: auxin response factor 4-like isoform X1
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLQ2LAI90.0Q2LAI9_SOLLC; Auxin response factor
STRINGSolyc11g069190.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51432234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4